GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
£0.00
Season Ticket

Season Ticket

£175.00 inc. tax

Season Ticket 2025-26 

Includes general admission to all home Isthmian League South Central and midweek cup (i.e. Isthmian League Cup & Surrey Senior Cup) games and friendlies; first option on F.A. competition tickets. 
Also includes Half Price Entry to all Raynes Park Vale F.C. Home League Matches.

Concessionary prices apply to Seniors (over 60), people with disabilities, and carers. You will be asked to provide evidence as appropriate at the checkout.

100% of the proceeds from the sale of this item are passed directly the Football Club.

The price for Season Tickets includes VAT at the standard rate. 

Season tickets can also be paid for by BACS (and this avoids paying c. 3.5% commission to this shop's hosting & payment engine). Please contact us for further details.

Product Code: BRVHOAg
Product Condition: New
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i